PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g055360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 730aa    MW: 78912.4 Da    PI: 5.6947
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g055360.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.31.4e-12231292162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Csa04g055360.1 231 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKMSYVMAENATLRQQ 292
                     678899**********************************9999999999999888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.2E-15231295IPR004827Basic-leucine zipper domain
PfamPF001701.7E-10232293IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208233293IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-16235293No hitNo description
SuperFamilySSF579591.0E-11235293No hitNo description
CDDcd147043.48E-21236287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MAEPITEQPP PPAPDPNSTH PPPSDFDSIS IPTFDDHFGS DQTPIGELMS DLGFPDGEFE  60
LTFDGMDDLY FPAENESFLI PINTSTQEHF GDFTPDSEAS GISGDSLLLP TTKDDAVTTS  120
GCCNRESPRE DSDDRCSGAD RSLDLPTPLS SQGSGNCGSD VSEATNESSP KSGNVVVDQK  180
VKVEEAVATT TTASIITKRK KEIEEDLSDE SRNSKYRRSG EDADASAVTG EEDEKKKARL  240
MRNRESAQLS RQRKKHYVEE LEEKVRNMHS TITDLNGKMS YVMAENATLR QQLGGNGMCP  300
PHHPPPPMAM YPPMAPMPYP WMPCPPYMVK QQGSQVPLIP IPRLKPQNPL GTSKAKKSES  360
KKSEAKTKKV ASISFLGLLF CLFLFGALAP IVDVNFGGIS GAFYGNYRSN YITDQVYSQH  420
RDRVLDASRS GAGTGVSNSN SGIHCGGDSD QGTRKNISAT ESSVPPGNGS EPLVASLFVP  480
RNDKLVKIDG NLIINSILAS EKAVASRKAS ESNERNADLV IPKDYSPALP LPDVRRTEEM  540
AKHLYRSKTE KQKALSSGSA DTLKDQFKTI AANGEMQQWF REGVAGPMFS SGMCTEVFQF  600
DVSSTSGAII PATPATNVSA VHSKNTTDTH KRKNRRILRG LPIPLPGSDF NLTKEHQRNS  660
SSKDIKPASS MVVSVLVDPR EGGDGDIEGM IGGPKSLSRV FVVVLLDSAK YVTYSCVLPR  720
SGAPHLVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505855.10.0PREDICTED: uncharacterized protein LOC104782582
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLD7LGH50.0D7LGH5_ARALL; BZIP transcription factor family protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein